PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zosma55g00480.1
Common NameZOSMA_55G00480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
Family MIKC_MADS
Protein Properties Length: 303aa    MW: 35091.3 Da    PI: 10.2101
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zosma55g00480.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.52.6e-3156106151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gklyeys+
  Zosma55g00480.1  56 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLYEYST 106
                      79***********************************************96 PP

2K-box87.42.8e-2913222111100
            K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                      +a + +++ e++kLk +i++Lq++qR+l Ged++sLs keLq+Le +Le++lk+iR +Kn+ll+++i+elq+k + +qe+n  L+kkl+e
  Zosma55g00480.1 132 TAPQGNMHLEYNKLKFKIDSLQKSQRQLTGEDVQSLSTKELQHLELRLESGLKQIRLRKNQLLFDSISELQRKGNIIQEQNIILEKKLKE 221
                      5556799********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-4048107IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.91248108IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.09E-3249125IPR002100Transcription factor, MADS-box
CDDcd002651.18E-4149126No hitNo description
PROSITE patternPS00350050104IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-315070IPR002100Transcription factor, MADS-box
PfamPF003191.3E-2557104IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-317085IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-3185106IPR002100Transcription factor, MADS-box
PfamPF014865.4E-25135219IPR002487Transcription factor, K-box
PROSITE profilePS5129715.816135225IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009933Biological Processmeristem structural organization
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MNQWYSNSAF RQKNLRYVNI TSPLPPTIIQ TLFINDRLPE VSGKVYRMGR GRVQLKRIEN  60
KINRQVTFSK RRSGLLKKAH EISVLCDAEV ALIVFSTKGK LYEYSTDSRM EKILERYEQQ  120
FYSQANLIPE DTAPQGNMHL EYNKLKFKID SLQKSQRQLT GEDVQSLSTK ELQHLELRLE  180
SGLKQIRLRK NQLLFDSISE LQRKGNIIQE QNIILEKKLK EKQKEKSALI PLLPHPHWEQ  240
QPNQLIPSNK TSPSNLNFTD PLPTLNMGAY EGSYRGEKEA ELPQSHTRNN LLPAWMIGHV  300
NV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A6e-2049119170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B6e-2049119170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C6e-2049119170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D6e-2049119170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A7e-2049119170Myocyte-specific enhancer factor 2A
3kov_B7e-2049119170Myocyte-specific enhancer factor 2A
3kov_I7e-2049119170Myocyte-specific enhancer factor 2A
3kov_J7e-2049119170Myocyte-specific enhancer factor 2A
3p57_A7e-2049119170Myocyte-specific enhancer factor 2A
3p57_B7e-2049119170Myocyte-specific enhancer factor 2A
3p57_C7e-2049119170Myocyte-specific enhancer factor 2A
3p57_D7e-2049119170Myocyte-specific enhancer factor 2A
3p57_I7e-2049119170Myocyte-specific enhancer factor 2A
3p57_J7e-2049119170Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00096ChIP-seqTransfer from AT1G69120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010260844.13e-91PREDICTED: truncated transcription factor CAULIFLOWER A
SwissprotQ424293e-78AGL8_SOLTU; Agamous-like MADS-box protein AGL8 homolog
TrEMBLA0A0K9NW420.0A0A0K9NW42_Z
STRINGGSMUA_Achr2P13650_0013e-89(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.12e-71MIKC_MADS family protein